High affinity immunoglobulin epsilon receptor subunit gamma
PDB Code:
Native
Stable
Pure
Active protein
Recombinant protein
Human Origin
Entry name:
FCERG_HUMAN
Gene name:
FCER1G
Uniprot accession:
P30273
Origin:
Homo sapiens (Human)
Protein family:
CD3Z/FCER1G
Full-length:
86
Mass:
9667
Sequence:
MIPAVVLLLLLLVEQAAALGEPQLCYILDAILFLYGIVLTLLYCRLKIQVRKAAITSYEKSDGVYTGLSTRNQETYETLKHEKPPQ


















