Putative transmembrane protein encoded by LINC00862
PDB Code:
Native
Stable
Pure
Active protein
Recombinant protein
Human Origin
Entry name:
SIM16_HUMAN
Gene name:
LINC00862
Uniprot accession:
A6NCI5
Origin:
Homo sapiens (Human)
Protein family:
nd
Full-length:
91
Mass:
10419
Sequence:
MVCYLYWETFPSISHLLKITLSARDCHVCGLNLFIFMDPVENQALHPVIMALILMPSLHCFGNILILLFLKSPAQLFCRMSVDLALLFPHK


















