Small regulatory polypeptide of amino acid response
PDB Code:
Native
Stable
Pure
Active protein
Recombinant protein
Human Origin
Entry name:
SPAR_HUMAN
Gene name:
SPAAR
Uniprot accession:
A0A1B0GVQ0
Origin:
Homo sapiens (Human)
Protein family:
nd
Full-length:
90
Mass:
9632
Sequence:
MGAKAPRGPKVAQWAMETAVIGVVVVLFVVTVAITCVLCCFSCDSRAQDPQGGPGRSFTVATFRQEASLFTGPVRHAQPVPSAQDFWTFM


















