ORM1-like protein 1

Negative regulator of sphingolipid synthesis.

PDB Code:
Native
Stable
Pure
Active protein
Recombinant protein
Human Origin
Entry name:
ORML1_HUMAN
Gene name:
ORMDL1
Uniprot accession:
Q9P0S3
Origin:
Homo sapiens (Human)
Protein family:
ORM
Full-length:
153
Mass:
17371
Sequence:
MNVGVAHSEVNPNTRVMNSRGMWLTYALGVGLLHIVLLSIPFFSVPVAWTLTNIIHNLGMYVFLHAVKGTPFETPDQGKARLLTHWEQLDYGVQFTSSRKFFTISPIILYFLASFYTKYDPTHFILNTASLLSVLIPKMPQLHGVRIFGINKY
CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes

Secure and boost
your discovery programs.

Starting from native material or recombinant systems, we succeed with all types of membrane proteins: GPCRs, Ion Channels, Transporters, Receptors and Viral Proteins.