RING finger protein 225

PDB Code:
Native
Stable
Pure
Active protein
Recombinant protein
Human Origin
Entry name:
RN225_HUMAN
Gene name:
RNF225
Uniprot accession:
M0QZC1
Origin:
Homo sapiens (Human)
Protein family:
nd
Full-length:
329
Mass:
34789
Sequence:
MPCPRPFWLRHSRAPQGSGPSSPGSLSAPRSPSRGEDQEEEEEEEGDGSPGSGPILPPASPVECLICVSSFDGVFKLPKRLDCGHVFCLECLARLSLATAGGGNAVACPVCRAPTRLAPRRGLPALPTQSGLLPRDARAPPSRQGSVRFDRRRGLLYLRPPPPPPGPRKARAPPPPPPLRLGRPLSRRLSLASPAWVFNAAVALAVLVAAGLVVSGVYIFFLIPHATSSGPPRPQLVALAPAPGFSWFPPRPPPGSPWAPAWTPRPTGPDLDTALPGTAEDALEPEAGPEDPAEAERTLDRRSDGTWGTEAGPGWAPWPRGARRLWGSQ
CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes

Secure and boost
your discovery programs.

Starting from native material or recombinant systems, we succeed with all types of membrane proteins: GPCRs, Ion Channels, Transporters, Receptors and Viral Proteins.