Transmembrane protein 223

Mitochondrial ribosome-associated protein involved in the first steps of cytochrome c oxidase complex (complex IV) biogenesis. Stimulates the translation of MT-CO1 mRNA and is a constituent of early MT-CO1 assembly intermediates.

PDB Code:
Native
Stable
Pure
Active protein
Recombinant protein
Human Origin
Entry name:
TM223_HUMAN
Gene name:
TMEM223
Uniprot accession:
A0PJW6
Origin:
Homo sapiens (Human)
Protein family:
TMEM223
Full-length:
202
Mass:
22049
Sequence:
MAAPWRRWPTGLLAVLRPLLTCRPLQGTTLQRDVLLFEHDRGRFFTILGLFCAGQGVFWASMAVAAVSRPPVPVQPLDAEVPNRGPFDLRSALWRYGLAVGCGAIGALVLGAGLLFSLRSVRSVVLRAGGQQVTLTTHAPFGLGAHFTVPLKQVSCMAHRGEVPAMLPLKVKGRRFYFLLDKTGHFPNTKLFDNTVGAYRSL
CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes

Secure and boost
your discovery programs.

Starting from native material or recombinant systems, we succeed with all types of membrane proteins: GPCRs, Ion Channels, Transporters, Receptors and Viral Proteins.